PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00633.1.g00100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 286aa    MW: 31324.4 Da    PI: 8.551
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00633.1.g00100.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.51.8e-141471148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..........TTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..........kgRtlkqcksrwqkyl 48
                                  +g+WT+eEd++l+ ++k +G g+W++ ++             + R++k+c++rw +yl
  Zmw_sc00633.1.g00100.1.sm.mk 14 KGAWTKEEDQRLIAYIKAHGEGCWRSLPKAADaltadgcatgLLRCGKSCRLRWINYL 71
                                  79****************************************9*************97 PP

2Myb_DNA-binding58.31.8e-1877121147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg++T+eEdel+++ ++++G++ W++Ia +++ gRt++++k++w+++
  Zmw_sc00633.1.g00100.1.sm.mk  77 RGNFTEEEDELIIKFHELFGNK-WSLIAGRLP-GRTDNEIKNYWNTH 121
                                   89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.8E-23574IPR009057Homeodomain-like
PROSITE profilePS5129412.06971IPR017930Myb domain
SMARTSM007171.8E-111373IPR001005SANT/Myb domain
SuperFamilySSF466895.39E-2813118IPR009057Homeodomain-like
PfamPF002498.9E-131471IPR001005SANT/Myb domain
CDDcd001671.45E-91671No hitNo description
PROSITE profilePS5129428.48272126IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-2875126IPR009057Homeodomain-like
SMARTSM007173.2E-1876124IPR001005SANT/Myb domain
PfamPF002497.3E-1777121IPR001005SANT/Myb domain
CDDcd001671.38E-1479122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MGRSPCCEQA HTNKGAWTKE EDQRLIAYIK AHGEGCWRSL PKAADALTAD GCATGLLRCG  60
KSCRLRWINY LRPDLKRGNF TEEEDELIIK FHELFGNKWS LIAGRLPGRT DNEIKNYWNT  120
HVKRKLLARG IDPQTHRPVS ATATAAAPAQ PHYQPPAQKP ASPPGGHHHH QPPSQSPVAC  180
SHSSDEEPRP ATSPPPRLLD IDLNLSISLA PYQPAEESGD DKPLTLVPAA TTTAEAGDIN  240
VVPVCRCLNS LRYRPGVECV CGGASSRRQK PWARSSLLQA APCYRG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28141267108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978868.11e-125PREDICTED: myb-related protein Zm38
SwissprotP813939e-86MYB08_ANTMA; Myb-related protein 308
SwissprotQ9SZP11e-85MYB4_ARATH; Transcription repressor MYB4
TrEMBLK3ZJI11e-125K3ZJI1_SETIT; Uncharacterized protein
STRINGSi026734m1e-124(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448